PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr028904.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 346aa    MW: 38328.8 Da    PI: 6.0342
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr028904.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.6e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l +++++ G g+W++ ++  g++R++k+c++rw +yl
      Pbr028904.1 14 KGPWTSEEDQRLMKYIQKNGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding55.91e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ +++++  lG++ W++Ia++++ gRt++++k++w+++l
      Pbr028904.1  67 RGKFSQEEEQTILNLHSILGNK-WSAIASHLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.4E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.618961IPR017930Myb domain
SuperFamilySSF466892.02E-3111108IPR009057Homeodomain-like
SMARTSM007174.0E-131363IPR001005SANT/Myb domain
PfamPF002493.3E-161461IPR001005SANT/Myb domain
CDDcd001673.59E-101661No hitNo description
PROSITE profilePS5129426.74462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.5E-2865117IPR009057Homeodomain-like
SMARTSM007173.6E-1766114IPR001005SANT/Myb domain
PfamPF002491.8E-1667112IPR001005SANT/Myb domain
CDDcd001676.87E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MGRSPCCDES GLKKGPWTSE EDQRLMKYIQ KNGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SQEEEQTILN LHSILGNKWS AIASHLPGRT DNEIKNFWNT HLKKKLIQMG  120
FDPMTHRPRT DIFSSLPHLL ALVNLKELLD HGSSHQSSWD EQALRLQAEA AQIARLQYLQ  180
CLLQSNNNSF GAATPNNLND FTDMETINLL NSLCSSQLDI QNPTAQYPVG NFQPVVQDNS  240
VPFSHLPDLQ AYPTPPSKDM VDNQAPDQFT AVLSQDESSP NNPWNIPSSS NTTPSPTSVA  300
PPVTVTEASV SNNMGDACST SSYGGVATSA WSDLLFEDPF FNEIA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-30121162105MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-30121162105C-Myb DNA-Binding Domain
1msf_C1e-30121162105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00180DAPTransfer from AT1G34670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009338099.10.0PREDICTED: transcription factor MYB39-like
SwissprotQ8GWP04e-73MYB39_ARATH; Transcription factor MYB39
TrEMBLM5W5260.0M5W526_PRUPE; Uncharacterized protein
STRINGPOPTR_0005s07590.11e-150(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.12e-98myb domain protein 93